SKU
PD0012

DLG1_2 PDZ Domain

Storage Conditions:
-30°C to -15°C
DLG1_2 PDZ Domain from Homo sapiens is a recombinant protein purified from Escherichia coli.
Availability
Produced On Demand
The protein is provided in 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2 and 25% (v/v) glycerol, at a 0.5 mg/mL concentration.
Sequence:
DDEITREPRKVVLHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEYSRFEAKIHDLREQMMNSSISS;;;
More Information
Shipping Conditions Room Temperature
Storage Conditions -30°C to -15°C
Optimal pH 7
Optimal Temperature 36.5 °C
Features Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli
Product Category PDZ Domains
Molecular Weight 13,12 KDa
DLG1_2 PDZ Domain
More Information
Shipping Conditions Room Temperature
Storage Conditions -30°C to -15°C
Optimal pH 7
Optimal Temperature 36.5 °C
Features Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli
Product Category PDZ Domains
Molecular Weight 13,12 KDa
Drug Discovery
More Information
Shipping Conditions Room Temperature
Storage Conditions -30°C to -15°C
Optimal pH 7
Optimal Temperature 36.5 °C
Features Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli
Product Category PDZ Domains
Molecular Weight 13,12 KDa
More Information
Shipping Conditions Room Temperature
Storage Conditions -30°C to -15°C
Optimal pH 7
Optimal Temperature 36.5 °C
Features Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli
Product Category PDZ Domains
Molecular Weight 13,12 KDa

MSDS

Material Safety Data Sheets

CoA

Certificate of Analysis

Please insert your lot number to get the available CoA

Manuals