We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
Only %1 left
SKU
DLG1_2 PDZ Domain
DLG1_2 PDZ Domain from Homo sapiens is a recombinant protein purified from Escherichia coli.
Availability
Produced On Demand
The protein is provided in 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2 and 25% (v/v) glycerol, at a 0.5 mg/mL concentration.
Sequence:
SEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMND
Sequence:
SEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMND
| Application | Drug Discovery | Optimal pH | 7 | Optimal Temperature | 36.5 °C | Features | Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli | Product Category | PDZ Domains | Molecular Weight | 13,12 KDa |
|---|
DLG1_2 PDZ Domain
| Application | Drug Discovery | Optimal pH | 7 | Optimal Temperature | 36.5 °C | Features | Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli | Product Category | PDZ Domains | Molecular Weight | 13,12 KDa |
|---|
| Application | Drug Discovery | Optimal pH | 7 | Optimal Temperature | 36.5 °C | Features | Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli | Product Category | PDZ Domains | Molecular Weight | 13,12 KDa |
|---|
CoA
Certificate of Analysis
