DLG1_2 PDZ Domain (PD0012)

Organism: Homo sapiens

136,00365,00

Clear

Sequence: SEKIMEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMND

MW: 13562 Da

Expression source: E. coli

Protein concentration: 0.5 mg/mL

pH: 7.0

Temperature: 36.5 °C

Storage: -20 ºC

Product Brochure EN
MSDS PT
MSDS EN