We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
SKU
VP0006
Alpha-like toxin Bom4, recombinant venom peptide
Sequence: GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC
Availability
Produced On Demand
Blue Ice / Wet Ice
Alpha-like toxin Bom4 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Buthus occitanus mardochei (Moroccan scorpion). Bom4 toxin binds voltage-independently sodium channels (Nav) and inhibits sodium channels inactivation, thereby blocking neuronal transmission. This alpha-like toxin was described as highly toxic to mice and insects. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.2 mg/mL concentration.
Sequence:
GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC
Sequence:
GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 8, Number of Disulfide bonds: 4, Protein concentration: 0.2 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 72,96 KDa |
Alpha-like toxin Bom4, recombinant venom peptide
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 8, Number of Disulfide bonds: 4, Protein concentration: 0.2 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 72,96 KDa |
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 8, Number of Disulfide bonds: 4, Protein concentration: 0.2 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 72,96 KDa |
CoA
Certificate of Analysis