Notification Bar Icon

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.Learn more

Learn more
SKU
VP0006

Alpha-like toxin Bom4, recombinant venom peptide

Storage Conditions:
2 °C to 8 °C
Sequence: GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC
Availability
Produced On Demand
Blue Ice / Wet Ice
Unit Size
0.1 mg
€449.00
Alpha-like toxin Bom4 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Buthus occitanus mardochei (Moroccan scorpion). Bom4 toxin binds voltage-independently sodium channels (Nav) and inhibits sodium channels inactivation, thereby blocking neuronal transmission. This alpha-like toxin was described as highly toxic to mice and insects. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.2 mg/mL concentration.
Sequence:
GCKDNFSANTCKHVKANNNCGSQKYATNCAKTCGKC
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 8, Number of Disulfide bonds: 4, Protein concentration: 0.2 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 72,96 KDa
Alpha-like toxin Bom4, recombinant venom peptide
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 8, Number of Disulfide bonds: 4, Protein concentration: 0.2 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 72,96 KDa
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 8, Number of Disulfide bonds: 4, Protein concentration: 0.2 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 72,96 KDa

MSDS

Material Safety Data Sheets

CoA

Certificate of Analysis

Please insert your lot number to get the available CoA

Manuals

 
Related Products