We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
SKU
VP0007
Insecticidal toxin LaIT1, recombinant venom peptide
Sequence: GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
Availability
Produced On Demand
Blue Ice / Wet Ice
Insecticidal LalT1 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Liocheles australasiae (Dwarf wood scorpion). The endogenous Insecticidal LalT1 peptide affects the activity of both ryanodinesensitive calcium-release channels RyR1 and RyR2. This venom peptide binds to different sites on the RyRs channels with highaffinity, mediating the full openings of these channels. Matsushita et al. described that insecticidal LalT1 venom peptide has insect toxicity activity against crickets but no toxicity was observed against mice, suggesting that the effect of this toxin is insect-selective. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration.
Sequence:
GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
Sequence:
GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 4, Number of Disulfide bonds: 2, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 42,07 KDa |
Insecticidal toxin LaIT1, recombinant venom peptide
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 4, Number of Disulfide bonds: 2, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 42,07 KDa |
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 4, Number of Disulfide bonds: 2, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 42,07 KDa |
MSDS
Material Safety Data Sheets
No files currently available for download
CoA
Certificate of Analysis