Notification Bar Icon

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.Learn more

Learn more
SKU
VP0007

Insecticidal toxin LaIT1, recombinant venom peptide

Storage Conditions:
2 °C to 8 °C
Sequence: GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
Availability
Produced On Demand
Blue Ice / Wet Ice
Unit Size
50 µg
€449.00
Insecticidal LalT1 venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Liocheles australasiae (Dwarf wood scorpion). The endogenous Insecticidal LalT1 peptide affects the activity of both ryanodinesensitive calcium-release channels RyR1 and RyR2. This venom peptide binds to different sites on the RyRs channels with highaffinity, mediating the full openings of these channels. Matsushita et al. described that insecticidal LalT1 venom peptide has insect toxicity activity against crickets but no toxicity was observed against mice, suggesting that the effect of this toxin is insect-selective. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.1 mg/mL concentration.
Sequence:
GNCKCDDEGPYVRTAPLTGYVDLGYCNEGWEKCASYYSPIAECCRKKK
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 4, Number of Disulfide bonds: 2, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 42,07 KDa
Insecticidal toxin LaIT1, recombinant venom peptide
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 4, Number of Disulfide bonds: 2, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 42,07 KDa
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 4, Number of Disulfide bonds: 2, Protein concentration: 0.1 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 42,07 KDa

MSDS

Material Safety Data Sheets
No files currently available for download

CoA

Certificate of Analysis

Please insert your lot number to get the available CoA

Manuals

 
Related Products