We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
SKU
VP0009
Potassium channel toxin Aek, recombinant venom peptide
Sequence: MICHNQQSSQPPTIKTCPGETNCYKKRWRDHRGTIIERGCGCPSVKKGVGIYCCKTNKCNR
Availability
Produced On Demand
Blue Ice / Wet Ice
Potassium channel toxin Aek venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of sea anemone Actinia equina (Beadlet anemone). Aek toxin binds to voltage-dependent potassium channels (Kv1/KCNA), thereby inhibiting the binding of 125I-alphadendrotoxin to rat synaptosomal membranes (Minagawa, S. et al. ). The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.4 mg/mL concentration.
Sequence:
MICHNQQSSQPPTIKTCPGETNCYKKRWRDHRGTIIERGCGCPSVKKGVGIYCCKTNKCNR
Sequence:
MICHNQQSSQPPTIKTCPGETNCYKKRWRDHRGTIIERGCGCPSVKKGVGIYCCKTNKCNR
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.4 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 38,13 KDa |
Potassium channel toxin Aek, recombinant venom peptide
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.4 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 38,13 KDa |
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.4 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 38,13 KDa |
MSDS
Material Safety Data Sheets
No files currently available for download
CoA
Certificate of Analysis