Notification Bar Icon

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.Learn more

Learn more
SKU
VP0009

Potassium channel toxin Aek, recombinant venom peptide

Storage Conditions:
2 °C to 8 °C
Sequence: MICHNQQSSQPPTIKTCPGETNCYKKRWRDHRGTIIERGCGCPSVKKGVGIYCCKTNKCNR
Availability
Produced On Demand
Blue Ice / Wet Ice
Unit Size
0.2 mg
€449.00
Potassium channel toxin Aek venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of sea anemone Actinia equina (Beadlet anemone). Aek toxin binds to voltage-dependent potassium channels (Kv1/KCNA), thereby inhibiting the binding of 125I-alphadendrotoxin to rat synaptosomal membranes (Minagawa, S. et al. ). The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.4 mg/mL concentration.
Sequence:
MICHNQQSSQPPTIKTCPGETNCYKKRWRDHRGTIIERGCGCPSVKKGVGIYCCKTNKCNR
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.4 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 38,13 KDa
Potassium channel toxin Aek, recombinant venom peptide
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.4 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 38,13 KDa
More Information
Shipping Conditions Blue Ice
Storage Conditions 2 °C to 8 °C
Application Drug Discovery
Features Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.4 mg/mL, Recombinant peptide purified from Escherichia coli
Product Category Venom Peptides
Molecular Weight 38,13 KDa

MSDS

Material Safety Data Sheets
No files currently available for download

CoA

Certificate of Analysis

Please insert your lot number to get the available CoA

Manuals

 
Related Products