Notification Bar Icon

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.

Unlock 5% OFF: Shop online now and save on every purchase! Limited time offer.Learn more

Learn more
Only %1 left
SKU

LMO7 PDZ Domain

Storage Conditions:
-30°C to -15°C
LMO7 PDZ Domain from Homo sapiens is a recombinant protein purified from Escherichia coli.
Availability
Produced On Demand
From €199.00
The protein is provided in 35 mM NaHepes buffer, pH 7.5, 750 mM NaCl, 200 mM imidazol, 3.5 mM CaCl2 and 25% (v/v) glycerol, at a 0.5 mg/mL concentration.
Sequence:
QFSDMRISINQTPGKSLDFGFTIKWDIPGIFVASVEAGSPAEFSQLQVDDEIIAINNTKFSYNDSKEWEEAMAKAQETGHLVMDVRRYGK
More Information
Shipping Conditions Room Temperature
Storage Conditions -30°C to -15°C
Application Drug Discovery
Optimal pH 7
Optimal Temperature 36.5 °C
Features Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli
Product Category PDZ Domains
Molecular Weight 13,1 KDa
LMO7 PDZ Domain
More Information
Shipping Conditions Room Temperature
Storage Conditions -30°C to -15°C
Application Drug Discovery
Optimal pH 7
Optimal Temperature 36.5 °C
Features Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli
Product Category PDZ Domains
Molecular Weight 13,1 KDa
More Information
Shipping Conditions Room Temperature
Storage Conditions -30°C to -15°C
Application Drug Discovery
Optimal pH 7
Optimal Temperature 36.5 °C
Features Optimum temperature: 36.5 °C, pH: 7.0, Protein concentration: 0.5 mg/mL, Recombinant protein purified from Escherichia coli
Product Category PDZ Domains
Molecular Weight 13,1 KDa

MSDS

Material Safety Data Sheets

CoA

Certificate of Analysis

Please insert your lot number to get the available CoA

Manuals

 
Related Products