We use cookies to make your experience better. To comply with the new e-Privacy directive, we need to ask for your consent to set the cookies. Learn more.
SKU
VP0003
Diapause-specific, recombinant venom peptide
Sequence: DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW
Availability
Produced On Demand
Blue Ice / Wet Ice
Diapause-specific venom peptide is a recombinant peptide purified from Escherichia coli that was originally isolated from the venom of Gastrophysa atrocyanea (leaf beetle). The endogenous diapausespecific peptide has attractive properties, such as antifungal activity, N-type voltage-gated Ca 2+ channel blocker and has high homology with amino acid sequences encoded in the insect iridescent virus. Tanaka et al. suggest that diapause-specific peptide can be utilized as a probe to analyse functional and evolutional of the life cycles of insects and iridoviruses. The recombinant peptide is provided in 50 mM NaHepes buffer, pH 7.5, 300 mM NaCl, at a 0.3 mg/mL concentration.
Sequence:
DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW
Sequence:
DFPLSKEYETCVRPRKCQPPLKCNKAQICVDPKKGW
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.3 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 44,7 KDa |
Diapause-specific, recombinant venom peptide
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.3 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 44,7 KDa |
Shipping Conditions | Blue Ice |
---|---|
Storage Conditions | 2 °C to 8 °C |
Application | Drug Discovery |
Features | Number of Cysteines: 6, Number of Disulfide bonds: 3, Protein concentration: 0.3 mg/mL, Recombinant peptide purified from Escherichia coli |
Product Category | Venom Peptides |
Molecular Weight | 44,7 KDa |
CoA
Certificate of Analysis